Bmp2 Peptide - middle region
Bmp2 Peptide - middle region
Product Specifications
Product Name Alternative
Bmp2
UniProt
P49001
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Bmp2 Rabbit Polyclonal Antibody (orb579383) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_058874
Preservative
Lyophilized powder
AA Sequence
EEKPGVSKRHVRISRSLHQDEHSWSQVRPLLVTFGHDGKGHPLHKREKRQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H3234 96 Tests
Sterile α motif domain-containing protein 9 (SAMD9) Human ELISA Kit
Sign In for Pricing
View Details 
TL302936V 500 µL Each
NMNAT3 Human shRNA Lentiviral Particle (Locus ID 349565)
Sign In for Pricing
View Details 
K0368105 3x 1.0 µg
CAV3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details TL519153V 500 µL Each
Oaz3 Mouse shRNA Lentiviral Particle (Locus ID 53814)
Sign In for Pricing
View Details