Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP6 Peptide - N-terminal region

BMP6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

VGR, VGR1

UniProt

P22004

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BMP6 Rabbit Polyclonal Antibody (orb584103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001709

Preservative

Lyophilized powder

AA Sequence

DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POR Antibody
29-984 100 µL

POR Antibody

Sign In for Pricing
View Details
RFC4 (NM_002916) Human Recombinant Protein
E45H42036M5 20 µg

RFC4 (NM_002916) Human Recombinant Protein

Sign In for Pricing
View Details
ISY1-RAB43 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV730124 1.0 µg DNA

ISY1-RAB43 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
UBAP2L Rabbit Polyclonal Antibody (Fluoro550)
orb3100642 100 µg

UBAP2L Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
ELISA kit for Human GST?1 (Glutathione S Transferase Omega 1)
E-EL-H1336 96 Tests

ELISA kit for Human GST?1 (Glutathione S Transferase Omega 1)

Sign In for Pricing
View Details
mmu-miR-5618-5p miRNA Inhibitor
MBS8296478-01 10 nmol

mmu-miR-5618-5p miRNA Inhibitor

Sign In for Pricing
View Details