Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP6 Peptide - N-terminal region

BMP6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

VGR, VGR1

UniProt

P22004

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BMP6 Rabbit Polyclonal Antibody (orb584103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001709

Preservative

Lyophilized powder

AA Sequence

DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bsg 3'UTR Luciferase Stable Cell Line
TU102862 1.0 mL

Bsg 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
LOC441018 Peptide - N-terminal region
orb2007547 100 µg

LOC441018 Peptide - N-terminal region

Sign In for Pricing
View Details
ODF3L2
487481 100 µL

ODF3L2

Sign In for Pricing
View Details
Mouse Adherin - Tight Junction Primer Library
MATJ-I 1 set

Mouse Adherin - Tight Junction Primer Library

Sign In for Pricing
View Details
Rabbit Polyclonal CREB3 regulatory factor Antibody [Allophycocyanin]
NBP3-06573APC 0.1 mL

Rabbit Polyclonal CREB3 regulatory factor Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Recombinant Mouse Lipocalin-2/NGAL/LCN2 Protein
E901064P 10 µg

Recombinant Mouse Lipocalin-2/NGAL/LCN2 Protein

Sign In for Pricing
View Details