Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP6 Peptide - N-terminal region

BMP6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

VGR, VGR1

UniProt

P22004

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BMP6 Rabbit Polyclonal Antibody (orb584103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001709

Preservative

Lyophilized powder

AA Sequence

DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (1,3-Dioxaindan-5-ylmethyl) -4-fluoroaniline
CIA59973-01 250 mg

N- (1,3-Dioxaindan-5-ylmethyl) -4-fluoroaniline

Sign In for Pricing
View Details
N- (1,3-Dioxaindan-5-ylmethyl) -4-fluoroaniline
CIA59973-02 2.5 g

N- (1,3-Dioxaindan-5-ylmethyl) -4-fluoroaniline

Sign In for Pricing
View Details
Olr141 Protein Vector (Rat) (pPM-C-HA)
33915026 500 ng

Olr141 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Bovine C-type lectin domain family 14 member A (CLEC14A) ELISA Kit
OM624273 96 Strip Well

Bovine C-type lectin domain family 14 member A (CLEC14A) ELISA Kit

Sign In for Pricing
View Details
Fbrsl1 3'UTR Lenti-reporter-Luc Vector
20287084 1.0 µg

Fbrsl1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TSC21 (TEX37) (Center) Rabbit Polyclonal Antibody
AP50604PU-N 400 µL

TSC21 (TEX37) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details