Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmp7 Peptide - N-terminal region

Bmp7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BMP-7, Bmp7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bmp7 Rabbit Polyclonal Antibody (orb574140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

BAA31853

Preservative

Lyophilized powder

AA Sequence

MVAFFKATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HECTD3
CSB-CL725567HU 10 μg Plasmid + 200 μL Glycerol

HECTD3

Sign In for Pricing
View Details
Bovine Prostaglandin ELISA
GTR10403383 96 Well

Bovine Prostaglandin ELISA

Sign In for Pricing
View Details
KIF5B antibody - N-terminal region
MBS3201781-01 0.1 mL

KIF5B antibody - N-terminal region

Sign In for Pricing
View Details
KIF5B antibody - N-terminal region
MBS3201781-02 5x 0.1 mL

KIF5B antibody - N-terminal region

Sign In for Pricing
View Details
RAGE Antibody - N-terminal region
ARP56743_P050-25UL 25 µL

RAGE Antibody - N-terminal region

Sign In for Pricing
View Details
Human AKAP6 knockdown cell line
ABC-KD0466 1 Vial

Human AKAP6 knockdown cell line

Sign In for Pricing
View Details