Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmp7 Peptide - N-terminal region

Bmp7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BMP-7, Bmp7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bmp7 Rabbit Polyclonal Antibody (orb574140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

BAA31853

Preservative

Lyophilized powder

AA Sequence

MVAFFKATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rickettsia prowazekii One-Step PCR kit
Oneq-VH306-150D 150 Reactions

Rickettsia prowazekii One-Step PCR kit

Sign In for Pricing
View Details
H28 siRNA Oligos set (Mouse)
22945174 3x 5 nmol

H28 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
M7G (3'-OMe-5') pppA (2'-OMe)
T74586-01 5 mg

M7G (3'-OMe-5') pppA (2'-OMe)

Sign In for Pricing
View Details
M7G (3'-OMe-5') pppA (2'-OMe)
T74586-02 50 mg

M7G (3'-OMe-5') pppA (2'-OMe)

Sign In for Pricing
View Details
TTL Protein Vector (Mouse) (pPM-C-HA)
48719024 500 ng

TTL Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ATP5SL (DMAC2) (NM_001167870) Human Tagged Lenti ORF Clone
RC229605L4 10 µg

ATP5SL (DMAC2) (NM_001167870) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details