Bnc1 Peptide - C-terminal region
Bnc1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI047752, AW546376, Bnc
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Bnc1 Rabbit Polyclonal Antibody (orb574582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_031588
Preservative
Lyophilized powder
AA Sequence
ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-C173665-25MG 25 mg
6-Carboxyfluorescein-4',5'-bis(2,2,2-trifluoroacetato)-di Mercurate
Sign In for Pricing
View Details 
AP07905PU-N 50 µg
Nav1.5 (SCN5A) (1548-1558) Goat Polyclonal Antibody
Sign In for Pricing
View Details 
BNC880966-500 1x 500 µL
Hepatocyte Specific (HepPar1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB0011-100 1x 100 µL
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/11), 0.2mg/mL
Sign In for Pricing
View Details 