Bnc1 Peptide - C-terminal region
Bnc1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI047752, AW546376, Bnc
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Bnc1 Rabbit Polyclonal Antibody (orb574582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_031588
Preservative
Lyophilized powder
AA Sequence
ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY400474 100 µg
BMAL1 (ARNTL) (NM_001178) Human Over-expression Lysate
Sign In for Pricing
View Details