Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bnc2 Peptide - C-terminal region

Bnc2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

5031434M05Rik, 8430420F16Rik, MGC124423, MGC124424

UniProt

Q8BMQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bnc2 Rabbit Polyclonal Antibody (orb577051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766458

Preservative

Lyophilized powder

AA Sequence

GTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAG1AP1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1781504 1.0 µg DNA

RAG1AP1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TMEM208 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV716084 1.0 µg DNA

TMEM208 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
BRIP2 Antibody
PHY7696A 150 μg

BRIP2 Antibody

Sign In for Pricing
View Details
VAMP2 (Vesicle Associated Membrane Protein 2, FLJ11460, SYB2, VAMP-2) (MaxLight 405)
MBS6442858-01 0.1 mL

VAMP2 (Vesicle Associated Membrane Protein 2, FLJ11460, SYB2, VAMP-2) (MaxLight 405)

Sign In for Pricing
View Details
VAMP2 (Vesicle Associated Membrane Protein 2, FLJ11460, SYB2, VAMP-2) (MaxLight 405)
MBS6442858-02 5x 0.1 mL

VAMP2 (Vesicle Associated Membrane Protein 2, FLJ11460, SYB2, VAMP-2) (MaxLight 405)

Sign In for Pricing
View Details
Human MTF2 qPCR Primer Pair
QH34001S 200 Tests

Human MTF2 qPCR Primer Pair

Sign In for Pricing
View Details