Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bnc2 Peptide - C-terminal region

Bnc2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

5031434M05Rik, 8430420F16Rik, MGC124423, MGC124424

UniProt

Q8BMQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bnc2 Rabbit Polyclonal Antibody (orb577051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766458

Preservative

Lyophilized powder

AA Sequence

GTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hoxd3 Rabbit Polyclonal Antibody (C-term)
E28PB1357 100 µL

Mouse Hoxd3 Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details
PAR4 (PAWR) Rabbit Polyclonal Antibody
AP06292PU-N 100 µg

PAR4 (PAWR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HDAC6 (Histone Deacetylase 6, FLJ16239, HD6, JM21) (FITC)
MBS6420086-01 0.1 mL

HDAC6 (Histone Deacetylase 6, FLJ16239, HD6, JM21) (FITC)

Sign In for Pricing
View Details
HDAC6 (Histone Deacetylase 6, FLJ16239, HD6, JM21) (FITC)
MBS6420086-02 5x 0.1 mL

HDAC6 (Histone Deacetylase 6, FLJ16239, HD6, JM21) (FITC)

Sign In for Pricing
View Details
Naloxegol oxalate
T3355-01 5 mg

Naloxegol oxalate

Sign In for Pricing
View Details
Naloxegol oxalate
T3355-02 10 mg

Naloxegol oxalate

Sign In for Pricing
View Details