Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNIP1 Peptide - C-terminal region

BNIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NIP1, SEC20, TRG-8

UniProt

Q12981

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BNIP1 Rabbit Polyclonal Antibody (orb331050) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001196

Preservative

Lyophilized powder

AA Sequence

QSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VX 745
TRC-V900500-50MG 50 mg

VX 745

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/1120), CF488A conjugate, 0.1mg/mL
BNC881120-500 1x 500 µL

Ep-CAM / CD326 (EGP40/1120), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Cyano-4-fluorobenzaldehyde
TRC-C987515-1G 1 g

3-Cyano-4-fluorobenzaldehyde

Sign In for Pricing
View Details
Recombinant LC3A Monoclonal Antibody
AN301015L-01 50 µL

Recombinant LC3A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant LC3A Monoclonal Antibody
AN301015L-02 100 µL

Recombinant LC3A Monoclonal Antibody

Sign In for Pricing
View Details
SAR1B (NM_016103) Human Recombinant Protein
TP310593M 100 µg

SAR1B (NM_016103) Human Recombinant Protein

Sign In for Pricing
View Details