Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNIP1 Peptide - C-terminal region

BNIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NIP1, SEC20, TRG-8

UniProt

Q12981

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BNIP1 Rabbit Polyclonal Antibody (orb331050) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001196

Preservative

Lyophilized powder

AA Sequence

QSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), 0.2mg/mL
BNUB2224-100 1x 100 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), 0.2mg/mL

Sign In for Pricing
View Details
WBP1 (NM_012477) Human Recombinant Protein
TP720539M 50 µg

WBP1 (NM_012477) Human Recombinant Protein

Sign In for Pricing
View Details
Pipette Pump BPIC-203
BPIC-203 1 Unit

Pipette Pump BPIC-203

Sign In for Pricing
View Details
Mix-n-StainTM CF®647 Nanobody Thiol Labeling Kit, 1x (5-20ug) labeling
#92593 1 Kit

Mix-n-StainTM CF®647 Nanobody Thiol Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097S-01 50 Tests

Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097S-02 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details