Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNIPL Peptide - middle region

BNIPL Peptide - middle region

Product Specifications

Product Name Alternative

BNIP-S, BNIPL-1, BNIPL-2, PP753

UniProt

Q7Z465

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BNIPL Rabbit Polyclonal Antibody (orb325754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612122

Preservative

Lyophilized powder

AA Sequence

AENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAE1 (NM_005500) Human Over-expression Lysate
LC401688 20 µg

SAE1 (NM_005500) Human Over-expression Lysate

Sign In for Pricing
View Details
Monobenzyl Terephthalate
TRC-M524930-10MG 10 mg

Monobenzyl Terephthalate

Sign In for Pricing
View Details
Transketolase Recombinant Rabbit monoclonal Antibody
HA751483 100 µL

Transketolase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Calcipressin 1 (RCAN1) Rabbit Monoclonal Antibody
TA424365 100 µL

Calcipressin 1 (RCAN1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human FNDC9 activation kit by CRISPRa
GA118400 1 Kit

Human FNDC9 activation kit by CRISPRa

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/1398), CF647 conjugate, 0.1mg/mL
BNC471398-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/1398), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details