Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNIPL Peptide - middle region

BNIPL Peptide - middle region

Product Specifications

Product Name Alternative

BNIP-S, BNIPL-1, BNIPL-2, PP753

UniProt

Q7Z465

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BNIPL Rabbit Polyclonal Antibody (orb325754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612122

Preservative

Lyophilized powder

AA Sequence

AENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Trefoil Factor 3, Intestinal (TFF3) ELISA Kit
RDR-TFF3-c-01 96 Tests

Canine Trefoil Factor 3, Intestinal (TFF3) ELISA Kit

Sign In for Pricing
View Details
Canine Trefoil Factor 3, Intestinal (TFF3) ELISA Kit
RDR-TFF3-c-02 48 Tests

Canine Trefoil Factor 3, Intestinal (TFF3) ELISA Kit

Sign In for Pricing
View Details
CHRDL1 Human Gene Knockout Kit (CRISPR)
KN402635 1 Kit

CHRDL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse I-PTH (intact Parathormone) ELISA Kit
E-EL-M0709-01 24 Tests

Mouse I-PTH (intact Parathormone) ELISA Kit

Sign In for Pricing
View Details
Mouse I-PTH (intact Parathormone) ELISA Kit
E-EL-M0709-02 48 Tests

Mouse I-PTH (intact Parathormone) ELISA Kit

Sign In for Pricing
View Details
Mouse I-PTH (intact Parathormone) ELISA Kit
E-EL-M0709-03 96 Tests

Mouse I-PTH (intact Parathormone) ELISA Kit

Sign In for Pricing
View Details