Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bola2 Peptide - N-terminal region

Bola2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1110025L05Rik, BolA-2

UniProt

Q8BGS2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bola2 Rabbit Polyclonal Antibody (orb576336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780312

Preservative

Lyophilized powder

AA Sequence

MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Conjugated Succinyl Triticum vulgare Lectin (Wheat Germ)-Succinyl WGA-
F-2102-2 1 mg

FITC Conjugated Succinyl Triticum vulgare Lectin (Wheat Germ)-Succinyl WGA-

Sign In for Pricing
View Details
NOLC1 Recombinant Rabbit Monoclonal Antibody [JE65-16]
HA721113 100 µL

NOLC1 Recombinant Rabbit Monoclonal Antibody [JE65-16]

Sign In for Pricing
View Details
Vaccum Pump BVAP-303
BVAP-303 1 Unit

Vaccum Pump BVAP-303

Sign In for Pricing
View Details
Purified Anti-Human CD127 Antibody[A019D5]
E-AB-F11520P-01 25 µg

Purified Anti-Human CD127 Antibody[A019D5]

Sign In for Pricing
View Details
Purified Anti-Human CD127 Antibody[A019D5]
E-AB-F11520P-02 100 µg

Purified Anti-Human CD127 Antibody[A019D5]

Sign In for Pricing
View Details
PPP4C Mouse Monoclonal Antibody [Clone ID: OTI2H7]
CF810219 100 µg

PPP4C Mouse Monoclonal Antibody [Clone ID: OTI2H7]

Sign In for Pricing
View Details