Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRAP Peptide - middle region

BRAP Peptide - middle region

Product Specifications

Product Name Alternative

BRAP2, IMP, RNF52

UniProt

Q7Z569

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRAP Rabbit Polyclonal Antibody (orb578708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006759

Preservative

Lyophilized powder

AA Sequence

YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Sheep Sideroflexin-1 (SFXN1)
orb2915479-01 20 µg

Recombinant Sheep Sideroflexin-1 (SFXN1)

Sign In for Pricing
View Details
Recombinant Sheep Sideroflexin-1 (SFXN1)
orb2915479-02 100 µg

Recombinant Sheep Sideroflexin-1 (SFXN1)

Sign In for Pricing
View Details
Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), partial
CSB-EP355782HU-01 10 µg

Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), partial

Sign In for Pricing
View Details
Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), partial
CSB-EP355782HU-02 50 µg

Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), partial

Sign In for Pricing
View Details
Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), partial
CSB-EP355782HU-03 200 µg

Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), partial

Sign In for Pricing
View Details
Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), partial
CSB-EP355782HU-04 500 µg

Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), partial

Sign In for Pricing
View Details