Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRCA1 Peptide - N-terminal region

BRCA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BRCAI, BRCC1, IRIS, PSCP, RNF53

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009229

Preservative

Lyophilized powder

AA Sequence

DLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse FAM71B shRNA Plasmid
abx984020-01 150 µg

Mouse FAM71B shRNA Plasmid

Sign In for Pricing
View Details
Mouse FAM71B shRNA Plasmid
abx984020-02 300 µg

Mouse FAM71B shRNA Plasmid

Sign In for Pricing
View Details
Rat Tmem131 Pre-designed siRNA Set B
SI214689B 1 Each

Rat Tmem131 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CDK5R1 Antibody
orb1262965 400 μl

CDK5R1 Antibody

Sign In for Pricing
View Details
NS 2028
B5627-50 50 mg

NS 2028

Sign In for Pricing
View Details
Two pore calcium channel protein 2 (TPCN2) (NM_139075) Human Over-expression Lysate
E45H13922-2 20 µg

Two pore calcium channel protein 2 (TPCN2) (NM_139075) Human Over-expression Lysate

Sign In for Pricing
View Details