Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRCA1 Peptide - N-terminal region

BRCA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BRCAI, BRCC1, IRIS, PSCP, RNF53

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009229

Preservative

Lyophilized powder

AA Sequence

DLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc75 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4746204 1.0 µg DNA

Ccdc75 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Cobra poison Protein Rabbit Polyclonal Antibody (BF680)
orb2557236 100 µL

Cobra poison Protein Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
C2orf39 sgRNA CRISPR Lentivector (Human) (Target 1)
K0223602 1.0 µg DNA

C2orf39 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ApoC-III discontinued
533142-01 30ul

ApoC-III discontinued

Sign In for Pricing
View Details
ApoC-III discontinued
533142-02 100 µL

ApoC-III discontinued

Sign In for Pricing
View Details
HCCS (CCHL, Cytochrome c-type Heme Lyase, Holocytochrome c-type Synthase) (MaxLight 550)
127745-ML550 100 µL

HCCS (CCHL, Cytochrome c-type Heme Lyase, Holocytochrome c-type Synthase) (MaxLight 550)

Sign In for Pricing
View Details