Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRCC3 Peptide - C-terminal region

BRCC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRCC36, C6.1A, CXorf53, RP11-143H17.2

UniProt

P46736

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRCC3 Rabbit Polyclonal Antibody (orb585188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_077308

Preservative

Lyophilized powder

AA Sequence

HNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QB / Complement C1q B-Chain (C1QB/2966), CF568 conjugate, 0.1mg/mL
BNC682966-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2966), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eph receptor B6 (EPHB6) Mouse Monoclonal Antibody [Clone ID: 2A6B9]
AM06213SU-N 100 µL

Eph receptor B6 (EPHB6) Mouse Monoclonal Antibody [Clone ID: 2A6B9]

Sign In for Pricing
View Details
NBL1 Antibody
KC-8114-01 50 μL

NBL1 Antibody

Sign In for Pricing
View Details
NBL1 Antibody
KC-8114-02 100 µL

NBL1 Antibody

Sign In for Pricing
View Details
NBL1 Antibody
KC-8114-03 1 mL

NBL1 Antibody

Sign In for Pricing
View Details
Trim52 Mouse Gene Knockout Kit (CRISPR)
KN518222 1 Kit

Trim52 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details