Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRCC3 Peptide - C-terminal region

BRCC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRCC36, C6.1A, CXorf53, RP11-143H17.2

UniProt

P46736

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRCC3 Rabbit Polyclonal Antibody (orb585189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077308

Preservative

Lyophilized powder

AA Sequence

KIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Centrin 3 (CETN3) Mouse Monoclonal Antibody [Clone ID: OTI3B5]
CF805890 100 µg

Centrin 3 (CETN3) Mouse Monoclonal Antibody [Clone ID: OTI3B5]

Sign In for Pricing
View Details
AMPK gamma 1 (PRKAG1) Human Gene Knockout Kit (CRISPR)
KN401845 1 Kit

AMPK gamma 1 (PRKAG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rab3gap1 Mouse Gene Knockout Kit (CRISPR)
KN514367 1 Kit

Rab3gap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EBP50 (SLC9A3R1) Human Gene Knockout Kit (CRISPR)
KN201653 1 Kit

EBP50 (SLC9A3R1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NELFB Polyclonal Antibody
E-AB-90323-01 60 µL

NELFB Polyclonal Antibody

Sign In for Pricing
View Details
NELFB Polyclonal Antibody
E-AB-90323-02 120 µL

NELFB Polyclonal Antibody

Sign In for Pricing
View Details