Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRF2 Peptide - middle region

BRF2 Peptide - middle region

Product Specifications

Product Name Alternative

BRFU, FLJ11052, TFIIIB50

UniProt

Q9HAW0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRF2 Rabbit Polyclonal Antibody (orb325593) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060780

Preservative

Lyophilized powder

AA Sequence

PPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAA

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (4-Acetylphenyl) acetonitrile
OR1039515-01 100 mg

2- (4-Acetylphenyl) acetonitrile

Sign In for Pricing
View Details
2- (4-Acetylphenyl) acetonitrile
OR1039515-02 250 mg

2- (4-Acetylphenyl) acetonitrile

Sign In for Pricing
View Details
2- (4-Acetylphenyl) acetonitrile
OR1039515-03 1 g

2- (4-Acetylphenyl) acetonitrile

Sign In for Pricing
View Details
CCNK Antibody - middle region : Biotin (ARP62003_P050-Biotin)
ARP62003_P050-Biotin 100 µL

CCNK Antibody - middle region : Biotin (ARP62003_P050-Biotin)

Sign In for Pricing
View Details
Human SDC4 shRNA Plasmid
abx954310-01 150 µg

Human SDC4 shRNA Plasmid

Sign In for Pricing
View Details
Human SDC4 shRNA Plasmid
abx954310-02 300 µg

Human SDC4 shRNA Plasmid

Sign In for Pricing
View Details