Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRMS1L Peptide - C-terminal region

BRMS1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRMS1, MGC11296

UniProt

Q5PSV4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRMS1L Rabbit Polyclonal Antibody (orb584671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115728

Preservative

Lyophilized powder

AA Sequence

GQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IZUMO3 activation kit by CRISPRa
GA119105 1 Kit

Human IZUMO3 activation kit by CRISPRa

Sign In for Pricing
View Details
FOXP3 (3G3), Biotin conjugate, 0.1mg/mL
BNCB0645-100 1x 100 µL

FOXP3 (3G3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARF5 Polyclonal Antibody
E-AB-19477-01 20 µL

ARF5 Polyclonal Antibody

Sign In for Pricing
View Details
ARF5 Polyclonal Antibody
E-AB-19477-02 60 µL

ARF5 Polyclonal Antibody

Sign In for Pricing
View Details
ARF5 Polyclonal Antibody
E-AB-19477-03 120 µL

ARF5 Polyclonal Antibody

Sign In for Pricing
View Details
ARF5 Polyclonal Antibody
E-AB-19477-04 200 µL

ARF5 Polyclonal Antibody

Sign In for Pricing
View Details