BRMS1L Peptide - C-terminal region
BRMS1L Peptide - C-terminal region
Product Specifications
Product Name Alternative
BRMS1, MGC11296
UniProt
Q5PSV4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BRMS1L Rabbit Polyclonal Antibody (orb584671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115728
Preservative
Lyophilized powder
AA Sequence
GQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PerCP/Cyanine5.5 Anti-Rat CD45 Antibody[OX-1]](https://cdn.genprice.uk/products/763/68dd14a9061270361e7d24c5/imageurl/e-ab-f1227j.webp)
E-AB-F1227J-01 50 Tests
PerCP/Cyanine5.5 Anti-Rat CD45 Antibody[OX-1]
Sign In for Pricing
View Details E-AB-F1227J-02 100 Tests
PerCP/Cyanine5.5 Anti-Rat CD45 Antibody[OX-1]
Sign In for Pricing
View Details E-AB-F1227J-03 2x 100 Tests
PerCP/Cyanine5.5 Anti-Rat CD45 Antibody[OX-1]
Sign In for Pricing
View Details 
![Proteasome 20S beta 7 (PSMB7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E10]](https://cdn.genprice.uk/products/937/68dd1b6d061270361ea1731d/imageurl/ta504382bm.webp)
TA504382BM 100 µL
Proteasome 20S beta 7 (PSMB7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E10]
Sign In for Pricing
View Details 