Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRMS1L Peptide - C-terminal region

BRMS1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRMS1, MGC11296

UniProt

Q5PSV4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRMS1L Rabbit Polyclonal Antibody (orb584672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115728

Preservative

Lyophilized powder

AA Sequence

LWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM22
338089-01 50 µL

TRIM22

Sign In for Pricing
View Details
TRIM22
338089-02 100 µL

TRIM22

Sign In for Pricing
View Details
28S ribosomal protein S11 mitochondrial (MRPS11) Human ELISA Kit
B0436 96 Tests

28S ribosomal protein S11 mitochondrial (MRPS11) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Human B2M/β2-MG Protein (His Tag)
PDEH100028-01 20 µg

Recombinant Human B2M/β2-MG Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human B2M/β2-MG Protein (His Tag)
PDEH100028-02 100 µg

Recombinant Human B2M/β2-MG Protein (His Tag)

Sign In for Pricing
View Details
CD11a (Leukocyte Function Associated Antigen, LFA-1, Integrin aL) (MaxLight 750)
MBS6256514-01 0.1 mL

CD11a (Leukocyte Function Associated Antigen, LFA-1, Integrin aL) (MaxLight 750)

Sign In for Pricing
View Details