Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRMS1L Peptide - C-terminal region

BRMS1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRMS1, MGC11296

UniProt

Q5PSV4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRMS1L Rabbit Polyclonal Antibody (orb584672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115728

Preservative

Lyophilized powder

AA Sequence

LWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYGB Antibody
orb239956-01 50 µg

PYGB Antibody

Sign In for Pricing
View Details
PYGB Antibody
orb239956-02 100 µg

PYGB Antibody

Sign In for Pricing
View Details
Antigen Retrieval Solution (Tris-EDTA, pH 8.0)
G1207-1L 1 L

Antigen Retrieval Solution (Tris-EDTA, pH 8.0)

Sign In for Pricing
View Details
Mouse Ugt3a1 activation kit by CRISPRa
GA211905 1 Kit

Mouse Ugt3a1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase subunit alpha (atpA), partial
MBS1014663-01 0.05 mg (E-Coli)

Recombinant Streptococcus pneumoniae ATP synthase subunit alpha (atpA), partial

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase subunit alpha (atpA), partial
MBS1014663-02 0.05 mg (Baculovirus)

Recombinant Streptococcus pneumoniae ATP synthase subunit alpha (atpA), partial

Sign In for Pricing
View Details