Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRUNOL5 Peptide - middle region

BRUNOL5 Peptide - middle region

Product Specifications

Product Name Alternative

BRUNOL-5, CELF5, CELF-5, BRUNOL5

UniProt

Q8N6W0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRUNOL5 Rabbit Polyclonal Antibody (orb324918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068757

Preservative

Lyophilized powder

AA Sequence

AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESAM (Endothelial Cell-selective Adhesion Molecule, UNQ220/PRO246, W117m)
MBS6012651-01 0.1 mg

ESAM (Endothelial Cell-selective Adhesion Molecule, UNQ220/PRO246, W117m)

Sign In for Pricing
View Details
ESAM (Endothelial Cell-selective Adhesion Molecule, UNQ220/PRO246, W117m)
MBS6012651-02 5x 0.1 mg

ESAM (Endothelial Cell-selective Adhesion Molecule, UNQ220/PRO246, W117m)

Sign In for Pricing
View Details
LRP5 Rabbit mAb
A22327-01 100 μL

LRP5 Rabbit mAb

Sign In for Pricing
View Details
LRP5 Rabbit mAb
A22327-02 20 µL

LRP5 Rabbit mAb

Sign In for Pricing
View Details
LRP5 Rabbit mAb
A22327-03 500 μL

LRP5 Rabbit mAb

Sign In for Pricing
View Details
LRP5 Rabbit mAb
A22327-04 1000 μL

LRP5 Rabbit mAb

Sign In for Pricing
View Details