Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRUNOL5 Peptide - middle region

BRUNOL5 Peptide - middle region

Product Specifications

Product Name Alternative

BRUNOL-5, CELF5, CELF-5, BRUNOL5

UniProt

Q8N6W0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRUNOL5 Rabbit Polyclonal Antibody (orb324919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068757

Preservative

Lyophilized powder

AA Sequence

GVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SIRP beta 1/CD172b Antibody
NBP2-13310-25ul 25 µL

Rabbit Polyclonal SIRP beta 1/CD172b Antibody

Sign In for Pricing
View Details
Ngp (NM_008694) Mouse Tagged ORF Clone Lentiviral Particle
MR214559L3V 200 µL

Ngp (NM_008694) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Kifc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
25698116 3x 1.0 µg

Kifc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Porcine Prolactin (PRL) ELISA Kit
RD-PRL-p-01 96 Tests

Porcine Prolactin (PRL) ELISA Kit

Sign In for Pricing
View Details
Porcine Prolactin (PRL) ELISA Kit
RD-PRL-p-02 48 Tests

Porcine Prolactin (PRL) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Rasal1 shRNA (UAS) - Lentiviral mouse Rasal1 shRNA (UAS) (25)
GTR15251309 1 Vial

Lentiviral mouse Rasal1 shRNA (UAS) - Lentiviral mouse Rasal1 shRNA (UAS) (25)

Sign In for Pricing
View Details