Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD12 Peptide - N-terminal region

BTBD12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1784, KIAA1987, MUS312, SLX4, FANCP, BTBD12

UniProt

Q8IY92

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTBD12 Rabbit Polyclonal Antibody (orb584482) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115820

Preservative

Lyophilized powder

AA Sequence

TKTLQGPAEKKPPSGSQAPRTKKQRVTKWQASEPAHSVNGEGGVLASAPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIRC5 (NM_001012271) Human Over-expression Lysate
LC423315 20 µg

BIRC5 (NM_001012271) Human Over-expression Lysate

Sign In for Pricing
View Details
PPHLN1 (NM_001143789) Human Over-expression Lysate
LY428349 100 µg

PPHLN1 (NM_001143789) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Neurovascular bundle
CS626463 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
Human ZNF683 activation kit by CRISPRa
GA116885 1 Kit

Human ZNF683 activation kit by CRISPRa

Sign In for Pricing
View Details
CD99 Recombinant Rabbit Monoclonal Antibody [JF0991]
ET1702-35 100 µL

CD99 Recombinant Rabbit Monoclonal Antibody [JF0991]

Sign In for Pricing
View Details
ATP6V0D2 Mouse Monoclonal Antibody [Clone ID: OTI2D6]
CF812166 100 µg

ATP6V0D2 Mouse Monoclonal Antibody [Clone ID: OTI2D6]

Sign In for Pricing
View Details