Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD12 Peptide - N-terminal region

BTBD12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1784, KIAA1987, MUS312, SLX4, FANCP, BTBD12

UniProt

Q8IY92

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTBD12 Rabbit Polyclonal Antibody (orb584482) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115820

Preservative

Lyophilized powder

AA Sequence

TKTLQGPAEKKPPSGSQAPRTKKQRVTKWQASEPAHSVNGEGGVLASAPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Acetate 3M, pH 5.2
EC-906 200 mL

Sodium Acetate 3M, pH 5.2

Sign In for Pricing
View Details
RNA/DNA/Protein Purification 96-Well Kit
51700 96 Preparations

RNA/DNA/Protein Purification 96-Well Kit

Sign In for Pricing
View Details
Polystyrene C4 NH₂
HB12516002.5G 5 g

Polystyrene C4 NH₂

Sign In for Pricing
View Details
TC 14012 TFA Salt
TRC-T012090-10MG 10 mg

TC 14012 TFA Salt

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/2877R), CF594 conjugate, 0.1mg/mL
BNC942877-100 1x 100 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Nonadecanol
TRC-N649323-50MG 50 mg

1-Nonadecanol

Sign In for Pricing
View Details