Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA Peptide - C-terminal region

BTLA Peptide - C-terminal region

Product Specifications

Product Name Alternative

BTLA1, CD272, FLJ16065, MGC129743

UniProt

Q7Z6A9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTLA Rabbit Polyclonal Antibody (orb331170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861445

Preservative

Lyophilized powder

AA Sequence

SRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PD-1 Quantikine ELISA Kit
DPD10 96 Tests

Human PD-1 Quantikine ELISA Kit

Sign In for Pricing
View Details
Bovine TG (Thyroglobulin) ELISA Kit
EKE62675 96 Tests

Bovine TG (Thyroglobulin) ELISA Kit

Sign In for Pricing
View Details
Prothrombin Fragment 1+2 (F1+2) High Sensitivity BioAssayTM ELISA Kit (Human)
517602 96 Tests

Prothrombin Fragment 1+2 (F1+2) High Sensitivity BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal VGF Antibody
NBP2-93869-0.1mL 0.1 mL

Rabbit Polyclonal VGF Antibody

Sign In for Pricing
View Details
Goat anti-Integrin alpha 11 (mouse) Antibody
MBS422612-01 0.1 mg

Goat anti-Integrin alpha 11 (mouse) Antibody

Sign In for Pricing
View Details
Goat anti-Integrin alpha 11 (mouse) Antibody
MBS422612-02 5x 0.1 mg

Goat anti-Integrin alpha 11 (mouse) Antibody

Sign In for Pricing
View Details