Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA Peptide - C-terminal region

BTLA Peptide - C-terminal region

Product Specifications

Product Name Alternative

BTLA1, CD272, FLJ16065, MGC129743

UniProt

Q7Z6A9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTLA Rabbit Polyclonal Antibody (orb331170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861445

Preservative

Lyophilized powder

AA Sequence

SRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CXCL3/GRO gamma Protein, His Tag
KMH953-01 100 µg

Recombinant Human CXCL3/GRO gamma Protein, His Tag

Sign In for Pricing
View Details
Recombinant Human CXCL3/GRO gamma Protein, His Tag
KMH953-02 50 µg

Recombinant Human CXCL3/GRO gamma Protein, His Tag

Sign In for Pricing
View Details
ICAD Double Nickase Plasmid (h2)
sc-403560-NIC-2 20 µg

ICAD Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
CLK1 Antibody
E51A02858 100 µL

CLK1 Antibody

Sign In for Pricing
View Details
Recombinant Anaerocellum thermophilum Elongation factor P (efp)
MBS1025579-01 0.02 mg (E-Coli)

Recombinant Anaerocellum thermophilum Elongation factor P (efp)

Sign In for Pricing
View Details
Recombinant Anaerocellum thermophilum Elongation factor P (efp)
MBS1025579-02 0.1 mg (E-Coli)

Recombinant Anaerocellum thermophilum Elongation factor P (efp)

Sign In for Pricing
View Details