Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA Peptide - middle region

BTLA Peptide - middle region

Product Specifications

Product Name Alternative

BTLA1, CD272, FLJ16065, MGC129743

UniProt

Q7Z6A9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTLA Rabbit Polyclonal Antibody (orb331171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861445

Preservative

Lyophilized powder

AA Sequence

GSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYSLLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Semaphorin 3c/SEMA3C Rabbit Polyclonal Antibody (Fluoro594)
orb3101857 100 µg

Semaphorin 3c/SEMA3C Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Recombinant Cynomolgus Monkey CPLX1 Protein, His (Fc)-Avi-tagged
CPLX1-167C 50 µg

Recombinant Cynomolgus Monkey CPLX1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Tbxas1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6806705 3x 1.0 µg

Tbxas1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (FITC)
MBS6176862-01 0.1 mL

TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (FITC)

Sign In for Pricing
View Details
TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (FITC)
MBS6176862-02 5x 0.1 mL

TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (FITC)

Sign In for Pricing
View Details
NTN1 Recombinant Protein (Human)
RP078909 100 µg

NTN1 Recombinant Protein (Human)

Sign In for Pricing
View Details