Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA Peptide - middle region

BTLA Peptide - middle region

Product Specifications

Product Name Alternative

BTLA1, CD272, FLJ16065, MGC129743

UniProt

Q7Z6A9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTLA Rabbit Polyclonal Antibody (orb331171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861445

Preservative

Lyophilized powder

AA Sequence

GSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYSLLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALK inhibitor 2
T3041-01 1 mg

ALK inhibitor 2

Sign In for Pricing
View Details
ALK inhibitor 2
T3041-02 2 mg

ALK inhibitor 2

Sign In for Pricing
View Details
ALK inhibitor 2
T3041-03 5 mg

ALK inhibitor 2

Sign In for Pricing
View Details
ALK inhibitor 2
T3041-04 10 mg

ALK inhibitor 2

Sign In for Pricing
View Details
ALK inhibitor 2
T3041-05 25 mg

ALK inhibitor 2

Sign In for Pricing
View Details
ALK inhibitor 2
T3041-06 50 mg

ALK inhibitor 2

Sign In for Pricing
View Details