Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Btrc Peptide - C-terminal region

Btrc Peptide - C-terminal region

Product Specifications

Product Name Alternative

Beta-Trcp1, FWD1, Fbw1a, KIAA4123, Slimb, b-TrCP, beta-TrCP, mKIAA4123, HOS

UniProt

Q3ULA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Btrc Rabbit Polyclonal Antibody (orb578362) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032847

Preservative

Lyophilized powder

AA Sequence

LVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAEPPRSPSRTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Platelet Glycoprotein Ib α chain (GP1BA) Canine ELISA Kit
F9459 96 Tests

Platelet Glycoprotein Ib α chain (GP1BA) Canine ELISA Kit

Sign In for Pricing
View Details
1,1,1,3,3,3-Hexafluoro-2- (4-hydroxyphenyl) propan-2-ol
228984-01 1 g

1,1,1,3,3,3-Hexafluoro-2- (4-hydroxyphenyl) propan-2-ol

Sign In for Pricing
View Details
1,1,1,3,3,3-Hexafluoro-2- (4-hydroxyphenyl) propan-2-ol
228984-02 5 g

1,1,1,3,3,3-Hexafluoro-2- (4-hydroxyphenyl) propan-2-ol

Sign In for Pricing
View Details
Recombinant Rhesus Macaque RPS4Y2 Protein, His (Fc)-Avi-tagged
RPS4Y2-3844R 50 µg

Recombinant Rhesus Macaque RPS4Y2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
DMRT1 (A-9) FITC
sc-377167 FITC 200 µg/mL

DMRT1 (A-9) FITC

Sign In for Pricing
View Details
3,9-Bis (2-cyanoethyl) -2,4,8,10-tetraoxaspiro[5.5]undecane
sc-485371 25 g

3,9-Bis (2-cyanoethyl) -2,4,8,10-tetraoxaspiro[5.5]undecane

Sign In for Pricing
View Details