Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BVES Peptide - middle region

BVES Peptide - middle region

Product Specifications

Product Name Alternative

HBVES, MGC42413, POP1, POPDC1

UniProt

Q8NE79

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BVES Rabbit Polyclonal Antibody (orb579888) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009004

Preservative

Lyophilized powder

AA Sequence

YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRF2 Rabbit mAb
C05993-01 20 µL

TRF2 Rabbit mAb

Sign In for Pricing
View Details
TRF2 Rabbit mAb
C05993-02 100 µL

TRF2 Rabbit mAb

Sign In for Pricing
View Details
TRF2 Rabbit mAb
C05993-03 2x 100 μL

TRF2 Rabbit mAb

Sign In for Pricing
View Details
Methyl hydrazine-1-carbohydrazono thioate hydroiodide discontinued
284297-01 500 mg

Methyl hydrazine-1-carbohydrazono thioate hydroiodide discontinued

Sign In for Pricing
View Details
Methyl hydrazine-1-carbohydrazono thioate hydroiodide discontinued
284297-02 1 g

Methyl hydrazine-1-carbohydrazono thioate hydroiodide discontinued

Sign In for Pricing
View Details
Methyl hydrazine-1-carbohydrazono thioate hydroiodide discontinued
284297-03 2 g

Methyl hydrazine-1-carbohydrazono thioate hydroiodide discontinued

Sign In for Pricing
View Details