Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BVES Peptide - middle region

BVES Peptide - middle region

Product Specifications

Product Name Alternative

HBVES, MGC42413, POP1, POPDC1

UniProt

Q8NE79

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BVES Rabbit Polyclonal Antibody (orb579888) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009004

Preservative

Lyophilized powder

AA Sequence

YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTP4 Antibody - middle region
ARP57612_P050-25UL 25 µL

RTP4 Antibody - middle region

Sign In for Pricing
View Details
Podxl 3'UTR GFP Stable Cell Line
TU266494 1.0 mL

Podxl 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human ETV3 siRNA
abx915746-01 15 nmol

Human ETV3 siRNA

Sign In for Pricing
View Details
Human ETV3 siRNA
abx915746-02 30 nmol

Human ETV3 siRNA

Sign In for Pricing
View Details
Recombinant Rotavirus A Non-structural glycoprotein 4
MBS1091339-01 0.02 mg (E-Coli)

Recombinant Rotavirus A Non-structural glycoprotein 4

Sign In for Pricing
View Details
Recombinant Rotavirus A Non-structural glycoprotein 4
MBS1091339-02 0.1 mg (E-Coli)

Recombinant Rotavirus A Non-structural glycoprotein 4

Sign In for Pricing
View Details