Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BZW1 Peptide - C-terminal region

BZW1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BZAP45, KIAA0005, Nbla10236

UniProt

B4DLZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BZW1 Rabbit Polyclonal Antibody (orb585379) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055485

Preservative

Lyophilized powder

AA Sequence

EVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Amino-2-propanol
TRC-A628135-50G 50 g

1-Amino-2-propanol

Sign In for Pricing
View Details
CCDC144NL (NM_001004306) Human Over-expression Lysate
LC424082 20 µg

CCDC144NL (NM_001004306) Human Over-expression Lysate

Sign In for Pricing
View Details
BMPR2 (NM_001204) Human Over-expression Lysate
LY420077 100 µg

BMPR2 (NM_001204) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CTRP2 (C1QTNF2) activation kit by CRISPRa
GA114487 1 Kit

Human CTRP2 (C1QTNF2) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Ileum
CR561311 5 µg

Tissue Total RNA, Ileum

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS702063 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details