BZW1 Peptide - C-terminal region
BZW1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
BZAP45, KIAA0005, Nbla10236
UniProt
B4DLZ8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BZW1 Rabbit Polyclonal Antibody (orb585379) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055485
Preservative
Lyophilized powder
AA Sequence
EVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![NFIB / NF1B2 Mouse Monoclonal Antibody [1H5]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea8168b/imageurl/em1701-69.webp)
BNC470994-100 1x 100 µL
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940373-100 1x 100 µL
Human IgM Immunoglobulin (IM373), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![FAM131C Mouse Monoclonal Antibody [Clone ID: OTI6F3]](https://cdn.genprice.uk/products/937/68dd18bb061270361e90894f/imageurl/cf810728.webp)
CF810728 100 µg
FAM131C Mouse Monoclonal Antibody [Clone ID: OTI6F3]
Sign In for Pricing
View Details