Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEND7 Peptide - middle region

BEND7 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ40283, MGC35247, C10orf30

UniProt

Q8N7W2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEND7 Rabbit Polyclonal Antibody (orb582791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689964

Preservative

Lyophilized powder

AA Sequence

LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYTL3, NT (SYTL3, SLP3, Synaptotagmin-like protein 3, Exophilin-6) (APC) discontinued
042541-APC 200 µL

SYTL3, NT (SYTL3, SLP3, Synaptotagmin-like protein 3, Exophilin-6) (APC) discontinued

Sign In for Pricing
View Details
FBXO8 (F-Box Protein 8, DC10, FBS, FBX8) (PE)
246030-PE 100 µL

FBXO8 (F-Box Protein 8, DC10, FBS, FBX8) (PE)

Sign In for Pricing
View Details
IL15 (Interleukin 15, IL-15, MGC9721) (MaxLight 550)
247538-ML550 100 µL

IL15 (Interleukin 15, IL-15, MGC9721) (MaxLight 550)

Sign In for Pricing
View Details
2- (2,4-Dinitrobenzyl) pyridine 95%
D46760-01 1 g

2- (2,4-Dinitrobenzyl) pyridine 95%

Sign In for Pricing
View Details
2- (2,4-Dinitrobenzyl) pyridine 95%
D46760-02 5 g

2- (2,4-Dinitrobenzyl) pyridine 95%

Sign In for Pricing
View Details
Recombinant Human DSG3 Protein, C-His
orb2834384-01 20 µg

Recombinant Human DSG3 Protein, C-His

Sign In for Pricing
View Details