Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEND7 Peptide - middle region

BEND7 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ40283, MGC35247, C10orf30

UniProt

Q8N7W2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEND7 Rabbit Polyclonal Antibody (orb582791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689964

Preservative

Lyophilized powder

AA Sequence

LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Halomicin A
orb3024728-01 10 mg

Halomicin A

Sign In for Pricing
View Details
Halomicin A
orb3024728-02 50 mg

Halomicin A

Sign In for Pricing
View Details
Bovine Galanin GAL ELISA Kit
BG-BVN11060 1 Each

Bovine Galanin GAL ELISA Kit

Sign In for Pricing
View Details
sRANK Ligand, murine recombinant
4557-50 50 µg

sRANK Ligand, murine recombinant

Sign In for Pricing
View Details
Anti-Integrin Alpha 4/Itga4 Antibody Picoband®, Carrier-free
A00468-2-carrier-free 100 µg/Vial

Anti-Integrin Alpha 4/Itga4 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Box of 100 Medium Qualitative Filter, 70 Mm
QL03A0070C Box of 100

Box of 100 Medium Qualitative Filter, 70 Mm

Sign In for Pricing
View Details