Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C11orf16 Peptide - middle region

C11orf16 Peptide - middle region

Product Specifications

UniProt

Q9NQ32

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C11orf16 Rabbit Polyclonal Antibody (orb583563) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065694

Preservative

Lyophilized powder

AA Sequence

EPCLGKPGTRYSNICKEEKDHKQQRAQTAVVGTTKELVSKATHMKPPRTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LSM4 Protein (His Tag)
PKSH033173-01 10 µg

Recombinant Human LSM4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LSM4 Protein (His Tag)
PKSH033173-02 50 µg

Recombinant Human LSM4 Protein (His Tag)

Sign In for Pricing
View Details
Caspase-10 Antibody
KC-7928-01 50 μL

Caspase-10 Antibody

Sign In for Pricing
View Details
Caspase-10 Antibody
KC-7928-02 100 µL

Caspase-10 Antibody

Sign In for Pricing
View Details
Caspase-10 Antibody
KC-7928-03 1 mL

Caspase-10 Antibody

Sign In for Pricing
View Details
ACTN3 (Center) Rabbit Polyclonal Antibody
AP50072PU-N 400 µL

ACTN3 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details