Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIKESHI Peptide - middle region

HIKESHI Peptide - middle region

Product Specifications

Product Name Alternative

HLD13, L7RN6, OPI10, HSPC138, HSPC179, C11orf73

UniProt

Q53FT3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIKESHI Rabbit Polyclonal Antibody (orb583361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057485

Preservative

Lyophilized powder

AA Sequence

DNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENTPD3 (NM_001248) Human Recombinant Protein
TP312912 20 µg

ENTPD3 (NM_001248) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS629324 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Di-n-butyl Phthalate-d22
TRC-D429496-2MG 2 mg

Di-n-butyl Phthalate-d22

Sign In for Pricing
View Details
FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]
E-AB-F1226C-01 50 Tests

FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]

Sign In for Pricing
View Details
FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]
E-AB-F1226C-02 100 Tests

FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]

Sign In for Pricing
View Details
FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]
E-AB-F1226C-03 2x 100 Tests

FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]

Sign In for Pricing
View Details