Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIKESHI Peptide - middle region

HIKESHI Peptide - middle region

Product Specifications

Product Name Alternative

HLD13, L7RN6, OPI10, HSPC138, HSPC179, C11orf73

UniProt

Q53FT3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIKESHI Rabbit Polyclonal Antibody (orb583361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057485

Preservative

Lyophilized powder

AA Sequence

DNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MID1IP1 Antibody
KC-33561-01 50 μL

MID1IP1 Antibody

Sign In for Pricing
View Details
MID1IP1 Antibody
KC-33561-02 100 µL

MID1IP1 Antibody

Sign In for Pricing
View Details
MID1IP1 Antibody
KC-33561-03 1 mL

MID1IP1 Antibody

Sign In for Pricing
View Details
Recombinant Mouse CD157/BST1 Protein (His Tag)
PKSM041363-01 10 µg

Recombinant Mouse CD157/BST1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD157/BST1 Protein (His Tag)
PKSM041363-02 50 µg

Recombinant Mouse CD157/BST1 Protein (His Tag)

Sign In for Pricing
View Details
DL-6-Hydroxy Norleucine
TRC-H948855-5G 5 g

DL-6-Hydroxy Norleucine

Sign In for Pricing
View Details