Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14orf177 Peptide - N-terminal region

C14orf177 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ25773

UniProt

Q52M58

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C14orf177 Rabbit Polyclonal Antibody (orb326037) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872366

Preservative

Lyophilized powder

AA Sequence

HKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-500 1x 500 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF488A conjugate, 0.1mg/mL
BNC880999-500 1x 500 µL

Cytokeratin, pan (Cocktail PAN-CK), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mesothelin (Mesothelial Marker) (MSLN/2131), CF488A conjugate, 0.1mg/mL
BNC882131-500 1x 500 µL

Mesothelin (Mesothelial Marker) (MSLN/2131), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details