Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14orf28 Peptide - middle region

C14orf28 Peptide - middle region

Product Specifications

Product Name Alternative

DRIP1, c14_5270

UniProt

Q4W4Y0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C14orf28 Rabbit Polyclonal Antibody (orb581463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017923

Preservative

Lyophilized powder

AA Sequence

FTTVKLLWIWDKMEKQQYKSEVHKASLIIDLFGNEHDNFTKNLENLMSTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF/LE Purified Anti-Mouse CD3e Antibody[500A2]
AN003420-01 100 µg

AF/LE Purified Anti-Mouse CD3e Antibody[500A2]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD3e Antibody[500A2]
AN003420-02 1 mg

AF/LE Purified Anti-Mouse CD3e Antibody[500A2]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD3e Antibody[500A2]
AN003420-03 5 mg

AF/LE Purified Anti-Mouse CD3e Antibody[500A2]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD3e Antibody[500A2]
AN003420-04 25 mg

AF/LE Purified Anti-Mouse CD3e Antibody[500A2]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD3e Antibody[500A2]
AN003420-05 50 mg

AF/LE Purified Anti-Mouse CD3e Antibody[500A2]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD3e Antibody[500A2]
AN003420-06 100 mg

AF/LE Purified Anti-Mouse CD3e Antibody[500A2]

Sign In for Pricing
View Details