Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14orf28 Peptide - middle region

C14orf28 Peptide - middle region

Product Specifications

Product Name Alternative

DRIP1, c14_5270

UniProt

Q4W4Y0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C14orf28 Rabbit Polyclonal Antibody (orb581463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017923

Preservative

Lyophilized powder

AA Sequence

FTTVKLLWIWDKMEKQQYKSEVHKASLIIDLFGNEHDNFTKNLENLMSTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HDG6 | Homeobox-leucine zipper protein HDG6
AS18 4219 1 Each

Anti-HDG6 | Homeobox-leucine zipper protein HDG6

Sign In for Pricing
View Details
4-(1-Pyrenyl)butyramide
TRC-P989925-250MG 250 mg

4-(1-Pyrenyl)butyramide

Sign In for Pricing
View Details
NKTR Antibody
8C10518-AAT 50 µg

NKTR Antibody

Sign In for Pricing
View Details
LRRC61 Rabbit Polyclonal Antibody
TA378138 100 µL

LRRC61 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phthalic-13C6 Acid
TRC-P384484-1MG 1 mg

Phthalic-13C6 Acid

Sign In for Pricing
View Details
Human CCDC8 activation kit by CRISPRa
GA113329 1 Kit

Human CCDC8 activation kit by CRISPRa

Sign In for Pricing
View Details