Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC197 Peptide - N-terminal region

CCDC197 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C14orf48, c14_5713, LINC00521

UniProt

Q8NCU1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC197 Rabbit Polyclonal Antibody (orb326007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689990

Preservative

Lyophilized powder

AA Sequence

MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF640R conjugate, 0.1mg/mL
BNC402925-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARRDC3 Polyclonal Antibody
E-AB-65876-01 60 µL

ARRDC3 Polyclonal Antibody

Sign In for Pricing
View Details
ARRDC3 Polyclonal Antibody
E-AB-65876-02 120 µL

ARRDC3 Polyclonal Antibody

Sign In for Pricing
View Details
ARRDC3 Polyclonal Antibody
E-AB-65876-03 200 µL

ARRDC3 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Ang2 activation kit by CRISPRa
GA200184 1 Kit

Mouse Ang2 activation kit by CRISPRa

Sign In for Pricing
View Details
PDX1 (NM_000209) Human Over-expression Lysate
LY400074 100 µg

PDX1 (NM_000209) Human Over-expression Lysate

Sign In for Pricing
View Details