Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC197 Peptide - N-terminal region

CCDC197 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C14orf48, c14_5713, LINC00521

UniProt

Q8NCU1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC197 Rabbit Polyclonal Antibody (orb326007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689990

Preservative

Lyophilized powder

AA Sequence

MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (KLC709), 0.2mg/mL
BNUB0709-100 1x 100 µL

Human Kappa Light Chain (KLC709), 0.2mg/mL

Sign In for Pricing
View Details
1,5-Cyclooctadiene(pyridine)(tricyclohexylphosphine)iridium(I) Hexafluorophosphate
TRC-C984570-250MG 250 mg

1,5-Cyclooctadiene(pyridine)(tricyclohexylphosphine)iridium(I) Hexafluorophosphate

Sign In for Pricing
View Details
Human DLL1 (Delta-like protein 1) ELISA kit
E-EL-H6218-01 24 Tests

Human DLL1 (Delta-like protein 1) ELISA kit

Sign In for Pricing
View Details
Human DLL1 (Delta-like protein 1) ELISA kit
E-EL-H6218-02 48 Tests

Human DLL1 (Delta-like protein 1) ELISA kit

Sign In for Pricing
View Details
Human DLL1 (Delta-like protein 1) ELISA kit
E-EL-H6218-03 96 Tests

Human DLL1 (Delta-like protein 1) ELISA kit

Sign In for Pricing
View Details
Vmn2r54 Mouse Gene Knockout Kit (CRISPR)
KN519184 1 Kit

Vmn2r54 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details