C16orf57 Peptide - C-terminal region
C16orf57 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ13154, HVSL1, PN, C16orf57
UniProt
Q9BQ65
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C16orf57 Rabbit Polyclonal Antibody (orb331182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078874
Preservative
Lyophilized powder
AA Sequence
RFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740276-100 1x 100 µL
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741042-100 1x 100 µL
TRIM29 (TRIM29/1042), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882344-500 1x 500 µL
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details