C16orf61 Peptide - middle region
C16orf61 Peptide - middle region
Product Specifications
Product Name Alternative
2310061C15Rik, DC13, C16orf61
UniProt
Q9NRP2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C16orf61 Rabbit Polyclonal Antibody (orb583537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064573
Preservative
Lyophilized powder
AA Sequence
NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Cyanine7 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]](https://cdn.genprice.uk/products/763/68dd14ac061270361e7d2fba/imageurl/e-ab-f1094h.webp)
E-AB-F1094H-01 50 Tests
PE/Cyanine7 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
Sign In for Pricing
View Details E-AB-F1094H-02 100 Tests
PE/Cyanine7 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
Sign In for Pricing
View Details E-AB-F1094H-03 2x 100 Tests
PE/Cyanine7 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
Sign In for Pricing
View Details 
BNC741457-500 1x 500 µL
PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details