C16orf71 Peptide - middle region
C16orf71 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp686H2240, FLJ43261
UniProt
Q8IYS4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C16orf71 Rabbit Polyclonal Antibody (orb581797) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_631909
Preservative
Lyophilized powder
AA Sequence
GKSQLLQQLRAFQKGTAQPELPASKGPAGGRAQAPEDTAGSRTGRKQHMK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC143117-100 1x 100 µL
CD19 (B-Lymphocyte Marker) (CD19/3117), CF514 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![6-Hydroxy-5-iodo-7-oxabicyclo[2.2.1]heptane-2-carboxylic Acid Gamma-Lactone](https://cdn.genprice.uk/products/572/6330566216734/imageurl/trc-h943640-10mg.webp)
TRC-H943640-10MG 10 mg
6-Hydroxy-5-iodo-7-oxabicyclo[2.2.1]heptane-2-carboxylic Acid Gamma-Lactone
Sign In for Pricing
View Details 
TAF-443-1 1 mL
Texas Red Conjugated Goat Affinity Purified Antibody to Mouse IgG (min.x Hu., Bov., Eq.)
Sign In for Pricing
View Details